BAF53b Antibody from NEUROMAB
Search, find, compare suppliers for anti-BAF53b antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | BAF53b |
| Clone | N332B/15 |
| Host Species | Mouse |
| Reactive Species | human and mouse |
| Isotype | IgG1 |
| Format | FL490 conjugate |
| Size | 200 µL |
| Concentration | 0.5 mg/mL |
| Applications | ICC, IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse anti-BAF53b monoclonal antibody, FL490 conjugated. Does not cross-react with BAF53a. RRID: AB_2940084 |
| Immunogen | Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli |
| Other Names | Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B) |
| Gene, Accession # | ACTL6B ACTL6 BAF53B, UniProt: O94805 |
| Catalog # | 75-311-FL490 |
| Price | $460 |
| Order / More Info | BAF53b Antibody from NEUROMAB |
| Product Specific References | n/a |
NEUROMAB
NEUROMAB
Produced and sold by Antibodies Inc.
P.O. Box 1560
Davis CA 95617-1560
P: (530) 758-4400
P: (800) 824-8540
F: (530) 758-6307
info@antibodiesinc.com
Ordering: orders@antibodiesinc.com
https://www.antibodiesinc.com/
Profile of NEUROMAB