Edit |   |
---|---|
Antigenic Specificity | MFF |
Clone | N382/14 |
Host Species | Mouse |
Reactive Species | human, mouse, and rat |
Isotype | IgG1 |
Format | FL490 conjugate |
Size | 200 µL |
Concentration | 0.5 mg/mL |
Applications | ICC, IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-MFF monoclonal antibody, FL490 conjugated. No cross-reactivity reported. RRID: AB_2940228 |
Immunogen | Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8); Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical); Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical); Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical) |
Other Names | Mitochondrial fission factor |
Gene, Accession # | MFF C2orf33 AD030 AD033 GL004, UniProt: Q9GZY8 |
Catalog # | 75-366-FL490 |
Price | $460 |
Order / More Info | MFF Antibody from NEUROMAB |
Product Specific References | n/a |