MFF Antibody from NEUROMAB
Search, find, compare suppliers for anti-MFF antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | MFF |
| Clone | N382/14 |
| Host Species | Mouse |
| Reactive Species | human, mouse, and rat |
| Isotype | IgG1 |
| Format | FL490 conjugate |
| Size | 200 µL |
| Concentration | 0.5 mg/mL |
| Applications | ICC, IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse anti-MFF monoclonal antibody, FL490 conjugated. No cross-reactivity reported. RRID: AB_2940228 |
| Immunogen | Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8); Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical); Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical); Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical) |
| Other Names | Mitochondrial fission factor |
| Gene, Accession # | MFF C2orf33 AD030 AD033 GL004, UniProt: Q9GZY8 |
| Catalog # | 75-366-FL490 |
| Price | $460 |
| Order / More Info | MFF Antibody from NEUROMAB |
| Product Specific References | n/a |
NEUROMAB
NEUROMAB
Produced and sold by Antibodies Inc.
P.O. Box 1560
Davis CA 95617-1560
P: (530) 758-4400
P: (800) 824-8540
F: (530) 758-6307
info@antibodiesinc.com
Ordering: orders@antibodiesinc.com
https://www.antibodiesinc.com/
Profile of NEUROMAB