GluA2/GluR2 Glutamate Receptor Antibody from NEUROMAB
Search, find, compare suppliers for anti-GluA2/GluR2 Glutamate Receptor antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | GluA2/GluR2 Glutamate Receptor |
| Clone | L21/32 |
| Host Species | Mouse |
| Reactive Species | human, mouse, and rat |
| Isotype | IgG1 |
| Format | FL490 conjugate |
| Size | 200 µL |
| Concentration | 0.5 mg/mL |
| Applications | ICC, IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse anti-GluA2/GluR2 Glutamate Receptor monoclonal antibody, FL490 conjugated. Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results). RRID: AB_2939068 |
| Immunogen | Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli |
| Other Names | Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2) |
| Gene, Accession # | Gria2 Glur2, UniProt: P19491 |
| Catalog # | 75-002-FL490 |
| Price | $515 |
| Order / More Info | GluA2/GluR2 Glutamate Receptor Antibody from NEUROMAB |
| Product Specific References | n/a |
NEUROMAB
NEUROMAB
Produced and sold by Antibodies Inc.
P.O. Box 1560
Davis CA 95617-1560
P: (530) 758-4400
P: (800) 824-8540
F: (530) 758-6307
info@antibodiesinc.com
Ordering: orders@antibodiesinc.com
https://www.antibodiesinc.com/
Profile of NEUROMAB
Return to Antibodies