Edit |   |
---|---|
Antigenic Specificity | Kir6.2 Potassium Channel |
Clone | N363/71 |
Host Species | Mouse |
Reactive Species | mouse and rat |
Isotype | IgG1 |
Format | FL650 conjugate |
Size | 200 µL |
Concentration | 0.5 mg/mL |
Applications | ICC, IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-Kir6.2 Potassium Channel monoclonal antibody, FL650 conjugated. Does not cross-react with Kir6.1. RRID: AB_2940295 |
Immunogen | Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS, cytoplasmic C-terminus) of rat Kir6.2 (accession number P70673) produced recombinantly in E. Coli |
Other Names | ATP-sensitive inward rectifier potassium channel 11 (BIR) (Inward rectifier K(+) channel Kir6.2) (Potassium channel, inwardly rectifying subfamily J member 11) |
Gene, Accession # | Kcnj11, UniProt: P70673 |
Catalog # | 75-393-FL650 |
Price | $460 |
Order / More Info | Kir6.2 Potassium Channel Antibody from NEUROMAB |
Product Specific References | n/a |