SUR2B Antibody from NEUROMAB
Search, find, compare suppliers for anti-SUR2B antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SUR2B |
| Clone | N323B/20 |
| Host Species | Mouse |
| Reactive Species | human, mouse, and rat |
| Isotype | IgG2b |
| Format | supernatant |
| Size | 5 mL |
| Concentration | Lot dependent |
| Applications | ICC, IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse anti-SUR2B monoclonal antibody. Does not cross-react with SUR1. RRID: AB_2341102 |
| Immunogen | Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli |
| Other Names | ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2) |
| Gene, Accession # | Abcc9 Sur2, UniProt: Q63563-2 |
| Catalog # | 73-399 |
| Price | $319 |
| Order / More Info | SUR2B Antibody from NEUROMAB |
| Product Specific References | n/a |
NEUROMAB
NEUROMAB
Produced and sold by Antibodies Inc.
P.O. Box 1560
Davis CA 95617-1560
P: (530) 758-4400
P: (800) 824-8540
F: (530) 758-6307
info@antibodiesinc.com
Ordering: orders@antibodiesinc.com
https://www.antibodiesinc.com/
Profile of NEUROMAB
Return to Antibodies